PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.K01165.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family NF-YB
Protein Properties Length: 221aa    MW: 24557.5 Da    PI: 6.5151
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.K01165.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB120.11e-3757148293
             NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 
                       re ++++ ian++ri+++vlPana i++dake +qec+sefi  +t+ea+ +c+re rkt+ ++d+l a+a+lG+e+y+epl+++l+k+r  
  Migut.K01165.1.p  57 REANHHMSIANITRIIRRVLPANAEITDDAKEAIQECISEFIRVITAEANVRCHREYRKTVMPEDVLAAMASLGLENYLEPLTTFLNKHRAQ 148
                       78999************************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.2E-3750156IPR009072Histone-fold
SuperFamilySSF471137.71E-3061160IPR009072Histone-fold
PfamPF008085.1E-1865126IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.0E-1290108No hitNo description
PRINTSPR006154.0E-12109127No hitNo description
PRINTSPR006154.0E-12128146No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MERGRCSDIE YKYTRRARTS GAPAVATAAA TNAAYIPAPP NAAVGEVNRE QQQGFKREAN  60
HHMSIANITR IIRRVLPANA EITDDAKEAI QECISEFIRV ITAEANVRCH REYRKTVMPE  120
DVLAAMASLG LENYLEPLTT FLNKHRAQQD PERNSMNQIL QFVRRGNTGG GDNSNGFVHP  180
QQQLGDQMVQ SPPPTATAST LGYYVHLPPP PFATVEDEEE R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A3e-2857146392NF-YB
4awl_B3e-2857146493NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A3e-2857146493NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012841020.11e-76PREDICTED: nuclear transcription factor Y subunit beta-like
TrEMBLA0A022QAG31e-148A0A022QAG3_ERYGU; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA6044436
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.13e-36NF-YB family protein